PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10008096m
Common NameCICLE_v10008096mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 495aa    MW: 54020.9 Da    PI: 7.0701
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10008096mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31271326156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Ciclev10008096m 271 KARRCWSPDLHRRFVSALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 326
                      68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-17268329IPR009057Homeodomain-like
PROSITE profilePS5129413.251268328IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-28269329IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-26271326IPR006447Myb domain, plants
PfamPF002491.4E-6273324IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MASPSELSLD CKPHSYSMLL KAFGDQAADH ETQKLEEVLA RLEEERFKID GLKRELPLCM  60
QLLTNAVEVS RQQLQAYRAT NQGPRPVLEE FIPLKNSSSE ISETKSQNIS DKANWMTTAQ  120
LWSQTGNNET KSQNTIAASP KETTTDIVGF NVISPKLALD TKQRNGGAFV PFSKERNSCP  180
SPTLRALPDL ALASPDKEMD HQDNRCSENE NGRRENLGNH NNNNKISNCN GGAVLHEQMK  240
GVAGNSTEGQ TNSNNPTNNN NNNNNNNTHR KARRCWSPDL HRRFVSALQM LGGSQVATPK  300
QIRELMKVDG LTNDEVKSHL QKYRLHTRRP SPSPQQAGAP APQLVVLGGI WVPSEYTTAA  360
AAAHSGTPAL YHHPSPHPPS HFCAASPVPQ DFYTTAAPAA PQPPPPLPPL SPAHHQLHLH  420
NQIHMYKATS QGHGSPESDI RGIGDRSESI EDGKSESSSW KGESGDNGVA ERKGLAALRE  480
DGEESNGSEI TLKF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.45780.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451029.10.0hypothetical protein CICLE_v10008096mg
TrEMBLV4WCU70.0V4WCU7_9R
STRINGPOPTR_0018s06410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-104G2-like family protein